Lineage for d4cyvf_ (4cyv F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646004Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries)
  8. 2646007Domain d4cyvf_: 4cyv F: [262664]
    Other proteins in same PDB: d4cyva_, d4cyvc_, d4cyve_
    automated match to d4cywf_
    complexed with edo, nag

Details for d4cyvf_

PDB Entry: 4cyv (more details), 2.3 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4cyvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyvf_ h.3.1.1 (F:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4cyvf_:

Click to download the PDB-style file with coordinates for d4cyvf_.
(The format of our PDB-style files is described here.)

Timeline for d4cyvf_: