SCOPe 2.05: Domain d4cyvf_: 4cyv F:

Lineage for d4cyvf_ (4cyv F:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries)

8. Domain d4cyvf_: 4cyv F: [262664]
   Other proteins in same PDB: d4cyva_, d4cyvc_, d4cyve_
   automated match to d4cywf_
   complexed with edo, nag

Details for d4cyvf_

PDB Entry: 4cyv, 2.3 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4cyvf_:

Sequence; same for both SEQRES and ATOM records:

>d4cyvf_ h.3.1.1 (F:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d4cyvf_:

• d4cyvf_ is new in SCOPe 2.05-stable
  
• d4cyvf_ appears in SCOPe 2.06
  
• d4cyvf_ appears in the current release, SCOPe 2.08