Lineage for d4cyve_ (4cyv E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2040943Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256744] (2 PDB entries)
  8. 2040946Domain d4cyve_: 4cyv E: [262663]
    Other proteins in same PDB: d4cyvb_, d4cyvd_, d4cyvf_
    automated match to d4f23a1
    complexed with edo, nag

Details for d4cyve_

PDB Entry: 4cyv (more details), 2.3 Å

PDB Description: Structure of the A_mallard_Sweden_51_2002 H10 Avian Haemmaglutinin
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4cyve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyve_ b.19.1.0 (E:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
kyvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d4cyve_:

Click to download the PDB-style file with coordinates for d4cyve_.
(The format of our PDB-style files is described here.)

Timeline for d4cyve_: