SCOPe 2.05: Domain d4cyvc_: 4cyv C:

Lineage for d4cyvc_ (4cyv C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256744] (2 PDB entries)

8. Domain d4cyvc_: 4cyv C: [262662]
   Other proteins in same PDB: d4cyvb_, d4cyvd_, d4cyvf_
   automated match to d4f23a1
   complexed with edo, nag

Details for d4cyvc_

PDB Entry: 4cyv, 2.3 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4cyvc_:

Sequence; same for both SEQRES and ATOM records:

>d4cyvc_ b.19.1.0 (C:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm
ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs
sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
kyvnkkslmlatgmrnvpe

Timeline for d4cyvc_:

• d4cyvc_ is new in SCOPe 2.05-stable
  
• d4cyvc_ appears in SCOPe 2.06
  
• d4cyvc_ appears in the current release, SCOPe 2.08