Lineage for d4cybj_ (4cyb J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318391Species Streptomyces coelicolor [TaxId:1902] [256735] (2 PDB entries)
  8. 2318401Domain d4cybj_: 4cyb J: [262658]
    automated match to d4cyba_
    complexed with fe, na

Details for d4cybj_

PDB Entry: 4cyb (more details), 1.78 Å

PDB Description: DpsC from Streptomyces coelicolor
PDB Compounds: (J:) putative DNA protection protein

SCOPe Domain Sequences for d4cybj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cybj_ a.25.1.0 (J:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
rtiqefgtvkqfpvaltmdtrlyscqrlnkvladtrilhdlykkyhwlmrgatfyqlhll
ldkhageqlelidtvaervqtlggvavgdprhvaeittvprppdgveevpsmlsrlleah
eliltechdaaartqeygddgtndllvsevlrtnelqawfvaehlvdtplvha

SCOPe Domain Coordinates for d4cybj_:

Click to download the PDB-style file with coordinates for d4cybj_.
(The format of our PDB-style files is described here.)

Timeline for d4cybj_: