| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:1902] [256735] (2 PDB entries) |
| Domain d4cybg_: 4cyb G: [262655] automated match to d4cyba_ complexed with fe, na |
PDB Entry: 4cyb (more details), 1.78 Å
SCOPe Domain Sequences for d4cybg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cybg_ a.25.1.0 (G:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
rtiqefgtvkqfpvaltmdtrlyscqrlnkvladtrilhdlykkyhwlmrgatfyqlhll
ldkhageqlelidtvaervqtlggvavgdprhvaeittvprppdgveevpsmlsrlleah
eliltechdaaartqeygddgtndllvsevlrtnelqawfvaehlvdtplvh
Timeline for d4cybg_: