SCOP 1.75: Domain d9esta_: 9est A:

Lineage for d9esta_ (9est A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (94 PDB entries)

8. Domain d9esta_: 9est A: [26265]
   complexed with ca, ibr, so4

Details for d9esta_

PDB Entry: 9est, 1.9 Å

PDB Description: structural study of porcine pancreatic elastase complexed with 7-amino-3-(2-bromoethoxy)-4-chloroisocoumarin as a nonreactivatable doubly covalent enzyme-inhibitor complex

PDB Compounds: (A:) porcine pancreatic elastase

SCOP Domain Sequences for d9esta_:

Sequence; same for both SEQRES and ATOM records:

>d9esta_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d9esta_:

• d9esta_ first appeared (with stable ids) in SCOP 1.55, called d9est__
  
• d9esta_ appears in SCOP 1.73
  
• d9esta_ appears in SCOPe 2.01
  
• d9esta_ appears in the current release, SCOPe 2.08