Lineage for d4cxaa_ (4cxa A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932655Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)
  8. 1933526Domain d4cxaa_: 4cxa A: [262648]
    Other proteins in same PDB: d4cxab1, d4cxab2, d4cxad1, d4cxad2
    automated match to d4un0c_
    complexed with anp

Details for d4cxaa_

PDB Entry: 4cxa (more details), 3.15 Å

PDB Description: crystal structure of the human cdk12-cyclin k complex bound to amppnp
PDB Compounds: (A:) cyclin-dependent kinase 12

SCOPe Domain Sequences for d4cxaa_:

Sequence, based on SEQRES records: (download)

>d4cxaa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireiki
lrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhik
sfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvi
tlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcp
avwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqs
dflkdvelskmappdlphwqdchelwskkrrrq

Sequence, based on observed residues (ATOM records): (download)

>d4cxaa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireiki
lrqlihrsvvnmkeivtdkqldfkkdkgafylvfeymdhdlmgllesglvhfsedhiksf
mkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseerpytnkvitlw
yrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavw
pdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdfl
kdvelskmappdlphwqdchelwskkrrrq

SCOPe Domain Coordinates for d4cxaa_:

Click to download the PDB-style file with coordinates for d4cxaa_.
(The format of our PDB-style files is described here.)

Timeline for d4cxaa_: