Lineage for d4cx7b_ (4cx7 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2236062Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2236063Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2236064Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2236862Protein automated matches [190421] (6 species)
    not a true protein
  7. 2237027Species Human (Homo sapiens) [TaxId:9606] [187302] (35 PDB entries)
  8. 2237105Domain d4cx7b_: 4cx7 B: [262646]
    automated match to d3e7gc_
    complexed with gol, h4b, hem, s71, so4

Details for d4cx7b_

PDB Entry: 4cx7 (more details), 3.16 Å

PDB Description: structure of human inos heme domain in complex with (r)-6-(3-amino-2-(5-(2-(6-amino-4- methylpyridin-2-yl)ethyl)pyridin-3-yl)propyl)-4- methylpyridin-2-amine
PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d4cx7b_:

Sequence, based on SEQRES records: (download)

>d4cx7b_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
d

Sequence, based on observed residues (ATOM records): (download)

>d4cx7b_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiclgsimtpksltrgprdkptppdellpqaiefvnq
yygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcigriqwsnl
qvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwnaqliryag
yqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeippdlvlev
amehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrdfcdvqry
nileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaesfmkymqn
eyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwqd

SCOPe Domain Coordinates for d4cx7b_:

Click to download the PDB-style file with coordinates for d4cx7b_.
(The format of our PDB-style files is described here.)

Timeline for d4cx7b_: