SCOPe 2.01: Domain d7este_: 7est E:

Lineage for d7este_ (7est E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (114 PDB entries)

8. Domain d7este_: 7est E: [26264]
   complexed with 0z2, ca, dmf, so4

Details for d7este_

PDB Entry: 7est, 1.8 Å

PDB Description: interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms

PDB Compounds: (E:) elastase

SCOPe Domain Sequences for d7este_:

Sequence; same for both SEQRES and ATOM records:

>d7este_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d7este_:

• d7este_ first appeared (with stable ids) in SCOP 1.55
  
• d7este_ appears in SCOP 1.75
  
• d7este_ appears in SCOPe 2.02
  
• d7este_ appears in the current release, SCOPe 2.08