| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
| Protein automated matches [190689] (87 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [187826] (18 PDB entries) |
| Domain d4cwac_: 4cwa C: [262639] automated match to d2i7ca_ complexed with 1pg, ja2 |
PDB Entry: 4cwa (more details), 2.02 Å
SCOPe Domain Sequences for d4cwac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cwac_ c.66.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni
Timeline for d4cwac_: