Lineage for d4ct4d2 (4ct4 D:302-462)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872184Domain d4ct4d2: 4ct4 D:302-462 [262632]
    Other proteins in same PDB: d4ct4b3
    automated match to d4ct4b2
    protein/RNA complex; complexed with cl, mg

Details for d4ct4d2

PDB Entry: 4ct4 (more details), 2.3 Å

PDB Description: CNOT1 MIF4G domain - DDX6 complex
PDB Compounds: (D:) probable ATP-dependent RNA helicase ddx6

SCOPe Domain Sequences for d4ct4d2:

Sequence, based on SEQRES records: (download)

>d4ct4d2 c.37.1.0 (D:302-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgysc
fyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhr
igrsgrfghlglainlityddrfnlksieeqlgteikpips

Sequence, based on observed residues (ATOM records): (download)

>d4ct4d2 c.37.1.0 (D:302-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgysc
fyihakmrqehrnrvfhdfrnglcrnlvctdlidiqavnvvinfdfpklaetylhrigrs
grfghlglainlityddrfnlksieeqlgteikpips

SCOPe Domain Coordinates for d4ct4d2:

Click to download the PDB-style file with coordinates for d4ct4d2.
(The format of our PDB-style files is described here.)

Timeline for d4ct4d2: