Lineage for d4csib_ (4csi B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374492Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 protein domains)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2374556Protein automated matches [190170] (17 species)
    not a true protein
  7. 2374579Species Humicola grisea [TaxId:5528] [259341] (1 PDB entry)
  8. 2374581Domain d4csib_: 4csi B: [262630]
    automated match to d4csia_
    complexed with nag, peg

Details for d4csib_

PDB Entry: 4csi (more details), 1.8 Å

PDB Description: Crystal structure of the thermostable Cellobiohydrolase Cel7A from the fungus Humicola grisea var. thermoidea.
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d4csib_:

Sequence, based on SEQRES records: (download)

>d4csib_ b.29.1.10 (B:) automated matches {Humicola grisea [TaxId: 5528]}
eqacsltterhpslswkkctaggqcqtvqasitldsnwrwthqvsgstncytgnkwdtsi
ctdakscaqnccvdgadytstygittngdslslkfvtkgqhstnvgsrtylmdgedkyqt
fellgneftfdvdvsnigcglngalyfvsmdadgglsrypgnkagakygtgycdaqcprd
ikfingeaniegwtgstndpnagagrygtccsemdiweannmataftphpctiigqsrce
gdscggtysneryagvcdpdgcdfnsyrqgnktfygkgmtvdttkkitvvtqflkdangd
lgeikrfyvqdgkiipnsestipgvegnsitqdwcdrqkvafgdiddfnrkggmkqmgka
lagpmvlvmsiwddhasnmlwldstfpvdaagkpgaergacpttsgvpaeveaeapnsnv
vfsnirfgpigstvaglpg

Sequence, based on observed residues (ATOM records): (download)

>d4csib_ b.29.1.10 (B:) automated matches {Humicola grisea [TaxId: 5528]}
eqacsltterhpslswkkctaggqcqtvqasitldsnwrwthqvsgstncytgnkwdtsi
ctdakscaqnccvdgadytstygittngdslslkfvtkgqhstnvgsrtylmdgedkyqt
fellgneftfdvdvsnigcglngalyfvsmdadgglsrypgnkagakygtgycdaqcprd
ikfingeaniegnagagrygtccsemdiweannmataftphpctiigqsrcegdscggty
sneryagvcdpdgcdfnsyrqgnktfygkgmtvdttkkitvvtqflkdangdlgeikrfy
vqdgkiipnsestipgvegnsitqdwcdrqkvafgdiddfnrkggmkqmgkalagpmvlv
msiwddhasnmlwldstfpvdaagkpgaergacpttsgvpaeveaeapnsnvvfsnirfg
pigstvaglpg

SCOPe Domain Coordinates for d4csib_:

Click to download the PDB-style file with coordinates for d4csib_.
(The format of our PDB-style files is described here.)

Timeline for d4csib_: