Lineage for d4cqzb_ (4cqz B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040912Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [419797] (7 PDB entries)
  8. 3040919Domain d4cqzb_: 4cqz B: [262627]
    Other proteins in same PDB: d4cqza_
    automated match to d2fk0b1
    complexed with mpo, nag; mutant

Details for d4cqzb_

PDB Entry: 4cqz (more details), 2.7 Å

PDB Description: crystal structure of h5 (vn1194) gln196arg mutant haemagglutinin
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4cqzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqzb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy

SCOPe Domain Coordinates for d4cqzb_:

Click to download the PDB-style file with coordinates for d4cqzb_.
(The format of our PDB-style files is described here.)

Timeline for d4cqzb_: