Lineage for d4cqmn1 (4cqm N:1-237)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095073Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2095166Domain d4cqmn1: 4cqm N:1-237 [262620]
    Other proteins in same PDB: d4cqmb2, d4cqmf2, d4cqmj2, d4cqmn2
    automated match to d4cqmb_
    complexed with act, edo, gol, nap

Details for d4cqmn1

PDB Entry: 4cqm (more details), 2.34 Å

PDB Description: Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP
PDB Compounds: (N:) carbonyl reductase family member 4

SCOPe Domain Sequences for d4cqmn1:

Sequence, based on SEQRES records: (download)

>d4cqmn1 c.2.1.0 (N:1-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvake
hdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamr
tmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgf
vhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil

Sequence, based on observed residues (ATOM records): (download)

>d4cqmn1 c.2.1.0 (N:1-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvake
hdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamr
tmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgf
vhtehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil

SCOPe Domain Coordinates for d4cqmn1:

Click to download the PDB-style file with coordinates for d4cqmn1.
(The format of our PDB-style files is described here.)

Timeline for d4cqmn1:

  • d4cqmn1 first appeared in SCOPe 2.05, called d4cqmn_