Lineage for d4cocb_ (4coc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706520Protein automated matches [226861] (4 species)
    not a true protein
  7. 2706524Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)
  8. 2706527Domain d4cocb_: 4coc B: [262603]
    automated match to d2xt1a_
    complexed with so4; mutant

Details for d4cocb_

PDB Entry: 4coc (more details), 1.59 Å

PDB Description: HIV-1 capsid C-terminal domain mutant (Y169L)
PDB Compounds: (B:) capsid protein p24

SCOPe Domain Sequences for d4cocb_:

Sequence, based on SEQRES records: (download)

>d4cocb_ a.28.3.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgvggpghkarvl

Sequence, based on observed residues (ATOM records): (download)

>d4cocb_ a.28.3.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgvgkarvl

SCOPe Domain Coordinates for d4cocb_:

Click to download the PDB-style file with coordinates for d4cocb_.
(The format of our PDB-style files is described here.)

Timeline for d4cocb_: