Lineage for d1easa_ (1eas A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802553Protein Elastase [50536] (4 species)
  7. 802563Species Pig (Sus scrofa) [TaxId:9823] [50538] (94 PDB entries)
  8. 802625Domain d1easa_: 1eas A: [26260]
    complexed with na, so4, tfk

Details for d1easa_

PDB Entry: 1eas (more details), 1.8 Å

PDB Description: nonpeptidic inhibitors of human leukocyte elastase. 3. design, synthesis, x-ray crystallographic analysis, and structure-activity relationships for a series of orally active 3-amino-6-phenylpyridin-2-one trifluoromethyl ketones
PDB Compounds: (A:) porcine pancreatic elastase

SCOP Domain Sequences for d1easa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1easa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1easa_:

Click to download the PDB-style file with coordinates for d1easa_.
(The format of our PDB-style files is described here.)

Timeline for d1easa_: