Lineage for d4cnoc_ (4cno C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2420460Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2420982Protein Type I 3-dehydroquinate dehydratase [51586] (4 species)
  7. 2420983Species Salmonella enterica [TaxId:90370] [260153] (5 PDB entries)
  8. 2420993Domain d4cnoc_: 4cno C: [262599]
    automated match to d1gqna_
    complexed with 9py

Details for d4cnoc_

PDB Entry: 4cno (more details), 1.5 Å

PDB Description: structure of the salmonella typhi type i dehydroquinase inhibited by a 3-dehydroquinic acid derivative
PDB Compounds: (C:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4cnoc_:

Sequence, based on SEQRES records: (download)

>d4cnoc_ c.1.10.1 (C:) Type I 3-dehydroquinate dehydratase {Salmonella enterica [TaxId: 90370]}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvlrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna

Sequence, based on observed residues (ATOM records): (download)

>d4cnoc_ c.1.10.1 (C:) Type I 3-dehydroquinate dehydratase {Salmonella enterica [TaxId: 90370]}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvlrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkpgqiavndlrs
vlmilhna

SCOPe Domain Coordinates for d4cnoc_:

Click to download the PDB-style file with coordinates for d4cnoc_.
(The format of our PDB-style files is described here.)

Timeline for d4cnoc_: