Lineage for d4cnoa_ (4cno A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085637Protein Type I 3-dehydroquinate dehydratase [51586] (4 species)
  7. 2085638Species Salmonella enterica [TaxId:90370] [260153] (5 PDB entries)
  8. 2085646Domain d4cnoa_: 4cno A: [262598]
    automated match to d1gqna_
    complexed with 9py

Details for d4cnoa_

PDB Entry: 4cno (more details), 1.5 Å

PDB Description: Structure of the Salmonella typhi Type I dehydroquinase inhibited by a 3-dehydroquinic acid derivative
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4cnoa_:

Sequence, based on SEQRES records: (download)

>d4cnoa_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella enterica [TaxId: 90370]}
ktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqsv
ltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftgd
advkatvdyahahnvyvvmsnhdfhqtpsaeemvlrlrkmqalgadipkiavmpqskhdv
ltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavnd
lrsvlmilhna

Sequence, based on observed residues (ATOM records): (download)

>d4cnoa_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella enterica [TaxId: 90370]}
ktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqsv
ltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftgd
advkatvdyahahnvyvvmsnhdfhqtpsaeemvlrlrkmqalgadipkiavmpqskhdv
ltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkpgqiavndlrsv
lmilhna

SCOPe Domain Coordinates for d4cnoa_:

Click to download the PDB-style file with coordinates for d4cnoa_.
(The format of our PDB-style files is described here.)

Timeline for d4cnoa_: