Lineage for d4cnil1 (4cni L:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756724Domain d4cnil1: 4cni L:1-106 [262596]
    Other proteins in same PDB: d4cnia_, d4cnib2, d4cnic_, d4cnid_, d4cnih_, d4cnil2
    automated match to d1dn0a1
    complexed with so4, tam

Details for d4cnil1

PDB Entry: 4cni (more details), 2.2 Å

PDB Description: crystal structure of the fab portion of olokizumab in complex with il- 6
PDB Compounds: (L:) olokizumab light chain, fab portion

SCOPe Domain Sequences for d4cnil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cnil1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdigislswyqqkpgkapklliynannladgvps
rfsgsgsgtdftltisslqpedfatyyclqhnsapytfgqgtklei

SCOPe Domain Coordinates for d4cnil1:

Click to download the PDB-style file with coordinates for d4cnil1.
(The format of our PDB-style files is described here.)

Timeline for d4cnil1: