Lineage for d4cmyw_ (4cmy W:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317263Species Chlorobaculum tepidum [TaxId:1097] [261204] (1 PDB entry)
  8. 2317286Domain d4cmyw_: 4cmy W: [262594]
    automated match to d1krqa_
    complexed with fe

Details for d4cmyw_

PDB Entry: 4cmy (more details), 2.59 Å

PDB Description: chlorobium tepidum ferritin
PDB Compounds: (W:) Ferritin

SCOPe Domain Sequences for d4cmyw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cmyw_ a.25.1.0 (W:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl

SCOPe Domain Coordinates for d4cmyw_:

Click to download the PDB-style file with coordinates for d4cmyw_.
(The format of our PDB-style files is described here.)

Timeline for d4cmyw_: