Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Chlorobaculum tepidum [TaxId:1097] [261204] (1 PDB entry) |
Domain d4cmyw_: 4cmy W: [262594] automated match to d1krqa_ complexed with fe |
PDB Entry: 4cmy (more details), 2.59 Å
SCOPe Domain Sequences for d4cmyw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cmyw_ a.25.1.0 (W:) automated matches {Chlorobaculum tepidum [TaxId: 1097]} mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
Timeline for d4cmyw_: