Lineage for d4cmyu_ (4cmy U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704011Species Chlorobaculum tepidum [TaxId:1097] [261204] (1 PDB entry)
  8. 2704032Domain d4cmyu_: 4cmy U: [262593]
    automated match to d1krqa_
    complexed with fe

Details for d4cmyu_

PDB Entry: 4cmy (more details), 2.59 Å

PDB Description: chlorobium tepidum ferritin
PDB Compounds: (U:) Ferritin

SCOPe Domain Sequences for d4cmyu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cmyu_ a.25.1.0 (U:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl

SCOPe Domain Coordinates for d4cmyu_:

Click to download the PDB-style file with coordinates for d4cmyu_.
(The format of our PDB-style files is described here.)

Timeline for d4cmyu_: