Lineage for d4cmyb_ (4cmy B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729730Species Chlorobaculum tepidum [TaxId:1097] [261204] (1 PDB entry)
  8. 1729732Domain d4cmyb_: 4cmy B: [262578]
    automated match to d1krqa_
    complexed with fe

Details for d4cmyb_

PDB Entry: 4cmy (more details), 2.59 Å

PDB Description: chlorobium tepidum ferritin
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d4cmyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cmyb_ a.25.1.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl

SCOPe Domain Coordinates for d4cmyb_:

Click to download the PDB-style file with coordinates for d4cmyb_.
(The format of our PDB-style files is described here.)

Timeline for d4cmyb_: