![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins) |
![]() | Protein automated matches [190114] (2 species) not a true protein |
![]() | Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries) |
![]() | Domain d4cj2d1: 4cj2 D:3-63 [262577] Other proteins in same PDB: d4cj2a_, d4cj2b_, d4cj2c2, d4cj2d2 automated match to d2xiwb_ complexed with gol |
PDB Entry: 4cj2 (more details), 1.5 Å
SCOPe Domain Sequences for d4cj2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cj2d1 b.34.13.1 (D:3-63) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]} kvkffwngeekevdtskivwvkragksvlfiyddngkngygdvtekdapkelldmlarae r
Timeline for d4cj2d1:
![]() Domains from other chains: (mouse over for more information) d4cj2a_, d4cj2b_, d4cj2c1, d4cj2c2 |