Lineage for d4cfqb_ (4cfq B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710348Protein automated matches [190132] (4 species)
    not a true protein
  7. 2710351Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)
  8. 2710380Domain d4cfqb_: 4cfq B: [262572]
    automated match to d2rgia_
    complexed with ca

Details for d4cfqb_

PDB Entry: 4cfq (more details), 1.37 Å

PDB Description: ca-bound truncated (delta13c) and c3s, c81s and c86s mutated s100a4 complexed with non-muscle myosin iia
PDB Compounds: (B:) Protein S100-A4

SCOPe Domain Sequences for d4cfqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cfqb_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
masplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
nldsnrdnevdfqeycvflssiam

SCOPe Domain Coordinates for d4cfqb_:

Click to download the PDB-style file with coordinates for d4cfqb_.
(The format of our PDB-style files is described here.)

Timeline for d4cfqb_: