SCOPe 2.07: Domain d4cewb_: 4cew B:

Lineage for d4cewb_ (4cew B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (22 species)
   not a true protein

7. Species Enterovirus a71 [TaxId:39054] [261947] (13 PDB entries)

8. Domain d4cewb_: 4cew B: [262570]
   Other proteins in same PDB: d4cewc_
   automated match to d4rqpc_
   complexed with 7j5

Details for d4cewb_

PDB Entry: 4cew, 2.75 Å

PDB Description: crystal structure of human enterovirus 71 in complex with the uncoating inhibitor ald

PDB Compounds: (B:) vp2

SCOPe Domain Sequences for d4cewb_:

Sequence; same for both SEQRES and ATOM records:

>d4cewb_ b.121.4.0 (B:) automated matches {Enterovirus a71 [TaxId: 39054]}
sdrvaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtk
lweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpe
yvigtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnn
catiivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglr
qavtq

Timeline for d4cewb_:

• d4cewb_ first appeared in SCOPe 2.05
  
• d4cewb_ appears in SCOPe 2.06
  
• d4cewb_ appears in the current release, SCOPe 2.08