Lineage for d1elaa_ (1ela A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2064890Protein Elastase [50536] (4 species)
  7. 2064908Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)
  8. 2065007Domain d1elaa_: 1ela A: [26257]
    complexed with 0z1, acy, ca, so4

Details for d1elaa_

PDB Entry: 1ela (more details), 2 Å

PDB Description: Analogous inhibitors of elastase do not always bind analogously
PDB Compounds: (A:) elastase

SCOPe Domain Sequences for d1elaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elaa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d1elaa_:

Click to download the PDB-style file with coordinates for d1elaa_.
(The format of our PDB-style files is described here.)

Timeline for d1elaa_: