Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Enterovirus a71 [TaxId:39054] [261947] (13 PDB entries) |
Domain d4cdqb_: 4cdq B: [262566] Other proteins in same PDB: d4cdqc_ automated match to d4rqpc_ complexed with 7vr, na |
PDB Entry: 4cdq (more details), 2.65 Å
SCOPe Domain Sequences for d4cdqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cdqb_ b.121.4.0 (B:) automated matches {Enterovirus a71 [TaxId: 39054]} sdrvaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtk lweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpe yvigtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnn catiivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglr qavtq
Timeline for d4cdqb_: