SCOPe 2.07: Domain d4cbxg_: 4cbx G:

Lineage for d4cbxg_ (4cbx G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein automated matches [226883] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)

8. Domain d4cbxg_: 4cbx G: [262565]
   Other proteins in same PDB: d4cbxa1, d4cbxa2
   automated match to d3cipg_
   complexed with atp, ca, na, po4, so4

Details for d4cbxg_

PDB Entry: 4cbx, 2.2 Å

PDB Description: crystal structure of plasmodium berghei actin ii

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d4cbxg_:

Sequence; same for both SEQRES and ATOM records:

>d4cbxg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvas
gf

Timeline for d4cbxg_:

• d4cbxg_ first appeared in SCOPe 2.05
  
• d4cbxg_ appears in SCOPe 2.06
  
• d4cbxg_ appears in the current release, SCOPe 2.08