SCOP 1.75: Domain d1qr3e_: 1qr3 E:

Lineage for d1qr3e_ (1qr3 E:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (94 PDB entries)

8. Domain d1qr3e_: 1qr3 E: [26255]
   complexed with aa3, aa4, aa6, ca, orn, so4

Details for d1qr3e_

PDB Entry: 1qr3, 1.6 Å

PDB Description: structure of porcine pancreatic elastase in complex with fr901277, a novel macrocyclic inhibitor of elastases at 1.6 angstrom resolution

PDB Compounds: (E:) Elastase 1

SCOP Domain Sequences for d1qr3e_:

Sequence; same for both SEQRES and ATOM records:

>d1qr3e_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1qr3e_:

• d1qr3e_ first appeared (with stable ids) in SCOP 1.55
  
• d1qr3e_ appears in SCOP 1.73
  
• d1qr3e_ appears in SCOPe 2.01
  
• d1qr3e_ appears in the current release, SCOPe 2.08