SCOPe 2.07: Domain d4bzxb_: 4bzx B:

Lineage for d4bzxb_ (4bzx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189039] (16 PDB entries)

8. Domain d4bzxb_: 4bzx B: [262548]
   automated match to d4bzpa_
   complexed with adx, anp, cit, edo, mg, peg

Details for d4bzxb_

PDB Entry: 4bzx, 1.7 Å

PDB Description: structure of the mycobacterium tuberculosis aps kinase cysc in complex with amppnp and aps

PDB Compounds: (B:) bifunctional enzyme cysn/cysc

SCOPe Domain Sequences for d4bzxb_:

Sequence; same for both SEQRES and ATOM records:

>d4bzxb_ c.37.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae
nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcerr
dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles

Timeline for d4bzxb_:

• d4bzxb_ first appeared in SCOPe 2.05
  
• d4bzxb_ appears in SCOPe 2.06
  
• d4bzxb_ appears in the current release, SCOPe 2.08