Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189039] (16 PDB entries) |
Domain d4bzxb_: 4bzx B: [262548] automated match to d4bzpa_ complexed with adx, anp, cit, edo, mg, peg |
PDB Entry: 4bzx (more details), 1.7 Å
SCOPe Domain Sequences for d4bzxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bzxb_ c.37.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} pprgktvwftglsgsgkssvamlverkllekgisayvldgdnlrhglnadlgfsmadrae nlrrlshvatlladcghlvlvpaisplaehralarkvhadagidffevfcdtplqdcerr dpkglyakarageithftgidspyqrpknpdlrltpdrsideqaqevidlles
Timeline for d4bzxb_: