| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein Pseudoazurin [49522] (4 species) |
| Species Thiosphaera pantotropha [TaxId:82367] [49526] (5 PDB entries) |
| Domain d4bxvb_: 4bxv B: [262547] automated match to d4bwua_ complexed with cu, so4; mutant |
PDB Entry: 4bxv (more details), 1.76 Å
SCOPe Domain Sequences for d4bxvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bxvb_ b.6.1.1 (B:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]}
athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela
qvn
Timeline for d4bxvb_: