Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins) automatically mapped to Pfam PF02966 |
Protein automated matches [190487] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256573] (2 PDB entries) |
Domain d4bwsa_: 4bws A: [262541] Other proteins in same PDB: d4bwsc_, d4bwsf_ automated match to d1qgva_ |
PDB Entry: 4bws (more details), 2.5 Å
SCOPe Domain Sequences for d4bwsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bwsa_ c.47.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvdit evpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrgar kgrglvvspkdys
Timeline for d4bwsa_: