Lineage for d4bwsa_ (4bws A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853477Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)
    automatically mapped to Pfam PF02966
  6. 1853485Protein automated matches [190487] (2 species)
    not a true protein
  7. 1853486Species Human (Homo sapiens) [TaxId:9606] [256573] (2 PDB entries)
  8. 1853491Domain d4bwsa_: 4bws A: [262541]
    Other proteins in same PDB: d4bwsc_, d4bwsf_
    automated match to d1qgva_

Details for d4bwsa_

PDB Entry: 4bws (more details), 2.5 Å

PDB Description: Crystal structure of the heterotrimer of PQBP1, U5-15kD and U5-52kD.
PDB Compounds: (A:) thioredoxin-like protein 4a

SCOPe Domain Sequences for d4bwsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwsa_ c.47.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvdit
evpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrgar
kgrglvvspkdys

SCOPe Domain Coordinates for d4bwsa_:

Click to download the PDB-style file with coordinates for d4bwsa_.
(The format of our PDB-style files is described here.)

Timeline for d4bwsa_: