Lineage for d4bwqg_ (4bwq G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877383Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)
    automatically mapped to Pfam PF02966
  6. 2877391Protein automated matches [190487] (2 species)
    not a true protein
  7. 2877392Species Human (Homo sapiens) [TaxId:9606] [256573] (2 PDB entries)
  8. 2877396Domain d4bwqg_: 4bwq G: [262540]
    automated match to d1qgva_

Details for d4bwqg_

PDB Entry: 4bwq (more details), 2.1 Å

PDB Description: Crystal structure of U5-15kD in a complex with PQBP1
PDB Compounds: (G:) thioredoxin-like protein 4a

SCOPe Domain Sequences for d4bwqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwqg_ c.47.1.8 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvdi
tevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrga
rkgrglvvspkdys

SCOPe Domain Coordinates for d4bwqg_:

Click to download the PDB-style file with coordinates for d4bwqg_.
(The format of our PDB-style files is described here.)

Timeline for d4bwqg_: