Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins) automatically mapped to Pfam PF02966 |
Protein automated matches [190487] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256573] (2 PDB entries) |
Domain d4bwqc_: 4bwq C: [262538] automated match to d1qgva_ |
PDB Entry: 4bwq (more details), 2.1 Å
SCOPe Domain Sequences for d4bwqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bwqc_ c.47.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvdit evpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrgar kgrglvvspkdys
Timeline for d4bwqc_: