Lineage for d4bwqc_ (4bwq C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132784Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)
    automatically mapped to Pfam PF02966
  6. 2132792Protein automated matches [190487] (2 species)
    not a true protein
  7. 2132793Species Human (Homo sapiens) [TaxId:9606] [256573] (2 PDB entries)
  8. 2132795Domain d4bwqc_: 4bwq C: [262538]
    automated match to d1qgva_

Details for d4bwqc_

PDB Entry: 4bwq (more details), 2.1 Å

PDB Description: Crystal structure of U5-15kD in a complex with PQBP1
PDB Compounds: (C:) thioredoxin-like protein 4a

SCOPe Domain Sequences for d4bwqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwqc_ c.47.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvdit
evpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrgar
kgrglvvspkdys

SCOPe Domain Coordinates for d4bwqc_:

Click to download the PDB-style file with coordinates for d4bwqc_.
(The format of our PDB-style files is described here.)

Timeline for d4bwqc_: