SCOPe 2.05: Domain d4bpgb_: 4bpg B:

Lineage for d4bpgb_ (4bpg B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (17 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries)

8. Domain d4bpgb_: 4bpg B: [262532]
   automated match to d4bpfa_

Details for d4bpgb_

PDB Entry: 4bpg, 2.2 Å

PDB Description: crystal structure of bacillus subtilis dltc

PDB Compounds: (B:) d-alanine--poly(phosphoribitol) ligase subunit 2

SCOPe Domain Sequences for d4bpgb_:

Sequence; same for both SEQRES and ATOM records:

>d4bpgb_ a.28.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mdfkqevldvlaevcqddivkenpdieifeeglldsfgtvelllaienrfdilvpitefd
rdvwntpnnivnqlselkr

Timeline for d4bpgb_:

• d4bpgb_ is new in SCOPe 2.05-stable
  
• d4bpgb_ is called d4bpgb1 in SCOPe 2.06
  
• d4bpgb_ appears in the current release, SCOPe 2.08, called d4bpgb1