![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries) |
![]() | Domain d4bp0d_: 4bp0 D: [262531] automated match to d4bp0a_ complexed with cl, gol, zn |
PDB Entry: 4bp0 (more details), 2.24 Å
SCOPe Domain Sequences for d4bp0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bp0d_ d.157.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} sdhvdlpynltatkidsdvfvvtdrdfyssnvlvakmldgtvvivsspfenlgtqtlmdw vaktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefy knedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkll fggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaeka vgem
Timeline for d4bp0d_: