SCOPe 2.06: Domain d4bp0b_: 4bp0 B:

Lineage for d4bp0b_ (4bp0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (16 PDB entries)

8. Domain d4bp0b_: 4bp0 B: [262529]
   automated match to d4bp0a_
   complexed with cl, gol, zn

Details for d4bp0b_

PDB Entry: 4bp0, 2.24 Å

PDB Description: crystal structure of the closed form of pseudomonas aeruginosa spm-1

PDB Compounds: (B:) metallo-b-lactamase

SCOPe Domain Sequences for d4bp0b_:

Sequence; same for both SEQRES and ATOM records:

>d4bp0b_ d.157.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sdhvdlpynltatkidsdvfvvtdrdfyssnvlvakmldgtvvivsspfenlgtqtlmdw
vaktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefy
knedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkll
fggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaeka
vgemr

Timeline for d4bp0b_:

• d4bp0b_ first appeared in SCOPe 2.05
  
• d4bp0b_ appears in SCOPe 2.07
  
• d4bp0b_ appears in the current release, SCOPe 2.08