Lineage for d4bl5f_ (4bl5 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847262Domain d4bl5f_: 4bl5 F: [262522]
    Other proteins in same PDB: d4bl5a2, d4bl5b2, d4bl5c2, d4bl5d2, d4bl5e2, d4bl5g2, d4bl5h2, d4bl5i2, d4bl5l2
    automated match to d4bkpc_
    complexed with edo, gfb, nap

Details for d4bl5f_

PDB Entry: 4bl5 (more details), 2.6 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp and product gdp-l-fucose
PDB Compounds: (F:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4bl5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bl5f_ c.2.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
tcawftdnyeqar

SCOPe Domain Coordinates for d4bl5f_:

Click to download the PDB-style file with coordinates for d4bl5f_.
(The format of our PDB-style files is described here.)

Timeline for d4bl5f_: