Lineage for d8este_ (8est E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404927Protein Elastase [50536] (4 species)
  7. 2404954Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)
  8. 2405015Domain d8este_: 8est E: [26252]
    complexed with ca, gis, so4

Details for d8este_

PDB Entry: 8est (more details), 1.78 Å

PDB Description: reaction of porcine pancreatic elastase with 7-substituted 3-alkoxy-4-chloroisocoumarins: design of potent inhibitors using the crystal structure of the complex formed with 4-chloro-3-ethoxy-7-guanidino-isocoumarin
PDB Compounds: (E:) porcine pancreatic elastase

SCOPe Domain Sequences for d8este_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8este_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d8este_:

Click to download the PDB-style file with coordinates for d8este_.
(The format of our PDB-style files is described here.)

Timeline for d8este_: