SCOPe 2.06: Domain d1b0ea_: 1b0e A:

Lineage for d1b0ea_ (1b0e A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)

8. Domain d1b0ea_: 1b0e A: [26251]
   complexed with ca, sei

Details for d1b0ea_

PDB Entry: 1b0e, 1.8 Å

PDB Description: crystal structure of porcine pancreatic elastase with mdl 101,146

PDB Compounds: (A:) protein (elastase)

SCOPe Domain Sequences for d1b0ea_:

Sequence; same for both SEQRES and ATOM records:

>d1b0ea_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1b0ea_:

• d1b0ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1b0ea_ appears in SCOPe 2.05
  
• d1b0ea_ appears in SCOPe 2.07
  
• d1b0ea_ appears in the current release, SCOPe 2.08