Lineage for d1b0ea_ (1b0e A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670617Protein Elastase [50536] (4 species)
  7. 670625Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)
  8. 670664Domain d1b0ea_: 1b0e A: [26251]
    complexed with ca, inh

Details for d1b0ea_

PDB Entry: 1b0e (more details), 1.8 Å

PDB Description: crystal structure of porcine pancreatic elastase with mdl 101,146
PDB Compounds: (A:) protein (elastase)

SCOP Domain Sequences for d1b0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ea_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1b0ea_:

Click to download the PDB-style file with coordinates for d1b0ea_.
(The format of our PDB-style files is described here.)

Timeline for d1b0ea_: