Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (13 species) not a true protein |
Species Human enterovirus 71 [TaxId:39054] [226325] (11 PDB entries) |
Domain d3zfeb_: 3zfe B: [262506] Other proteins in same PDB: d3zfec_ automated match to d4rqpc_ complexed with cl, na, sph |
PDB Entry: 3zfe (more details), 2.7 Å
SCOPe Domain Sequences for d3zfeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zfeb_ b.121.4.0 (B:) automated matches {Human enterovirus 71 [TaxId: 39054]} drvaqltignstittqeaaniivgygewpsycsdddatavdkptrpdvsvnrfytldtkl weksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvailpey vigtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnnc atiivpymntlpfdsalnhcnfgllvvpispldfdqgatpvipititlapmcsefaglrq avtq
Timeline for d3zfeb_: