Lineage for d3wyhb_ (3wyh B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926391Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 2926399Protein automated matches [191098] (3 species)
    not a true protein
  7. 2926412Species Struthio camelus [TaxId:8801] [260476] (1 PDB entry)
  8. 2926414Domain d3wyhb_: 3wyh B: [262501]
    automated match to d3wyha_
    complexed with p6g, tam; mutant

Details for d3wyhb_

PDB Entry: 3wyh (more details), 1.77 Å

PDB Description: Structure of disulfide bond deletion mutant of ostrich egg white lysozyme
PDB Compounds: (B:) Lysozyme g

SCOPe Domain Sequences for d3wyhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wyhb_ d.2.1.5 (B:) automated matches {Struthio camelus [TaxId: 8801]}
rtgsygdvnrvdttgassksakpeklnysgvaasrkiaerdlqsmdrykalikkvgqkls
vdpaviagiisreshagkalrngwgdngngfglmqvdrrshkpvgewngerhlmqgteil
ismikaiqkkfprwtkeqqlkggisaynagpgnvrsyermdigtthddyandvvaraqyy
kqhgy

SCOPe Domain Coordinates for d3wyhb_:

Click to download the PDB-style file with coordinates for d3wyhb_.
(The format of our PDB-style files is described here.)

Timeline for d3wyhb_: