SCOPe 2.08: Domain d3wyhb_: 3wyh B:

Lineage for d3wyhb_ (3wyh B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.5: G-type lysozyme [53987] (2 proteins)

6. Protein automated matches [191098] (3 species)
   not a true protein

7. Species Struthio camelus [TaxId:8801] [260476] (1 PDB entry)

8. Domain d3wyhb_: 3wyh B: [262501]
   automated match to d3wyha_
   complexed with p6g, tam; mutant

Details for d3wyhb_

PDB Entry: 3wyh, 1.77 Å

PDB Description: Structure of disulfide bond deletion mutant of ostrich egg white lysozyme

PDB Compounds: (B:) Lysozyme g

SCOPe Domain Sequences for d3wyhb_:

Sequence; same for both SEQRES and ATOM records:

>d3wyhb_ d.2.1.5 (B:) automated matches {Struthio camelus [TaxId: 8801]}
rtgsygdvnrvdttgassksakpeklnysgvaasrkiaerdlqsmdrykalikkvgqkls
vdpaviagiisreshagkalrngwgdngngfglmqvdrrshkpvgewngerhlmqgteil
ismikaiqkkfprwtkeqqlkggisaynagpgnvrsyermdigtthddyandvvaraqyy
kqhgy

Timeline for d3wyhb_:

• d3wyhb_ first appeared in SCOPe 2.05
  
• d3wyhb_ appears in SCOPe 2.07