![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.5: G-type lysozyme [53987] (2 proteins) |
![]() | Protein automated matches [191098] (3 species) not a true protein |
![]() | Species Struthio camelus [TaxId:8801] [260476] (1 PDB entry) |
![]() | Domain d3wyhb_: 3wyh B: [262501] automated match to d3wyha_ complexed with p6g, tam; mutant |
PDB Entry: 3wyh (more details), 1.77 Å
SCOPe Domain Sequences for d3wyhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wyhb_ d.2.1.5 (B:) automated matches {Struthio camelus [TaxId: 8801]} rtgsygdvnrvdttgassksakpeklnysgvaasrkiaerdlqsmdrykalikkvgqkls vdpaviagiisreshagkalrngwgdngngfglmqvdrrshkpvgewngerhlmqgteil ismikaiqkkfprwtkeqqlkggisaynagpgnvrsyermdigtthddyandvvaraqyy kqhgy
Timeline for d3wyhb_: