SCOPe 2.06: Domain d1elca_: 1elc A:

Lineage for d1elca_ (1elc A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)

8. Domain d1elca_: 1elc A: [26250]
   complexed with 0z3, ca

Details for d1elca_

PDB Entry: 1elc, 1.75 Å

PDB Description: Analogous inhibitors of elastase do not always bind analogously

PDB Compounds: (A:) elastase

SCOPe Domain Sequences for d1elca_:

Sequence; same for both SEQRES and ATOM records:

>d1elca_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1elca_:

• d1elca_ first appeared (with stable ids) in SCOP 1.55
  
• d1elca_ appears in SCOPe 2.05
  
• d1elca_ appears in SCOPe 2.07
  
• d1elca_ appears in the current release, SCOPe 2.08