Lineage for d1elca_ (1elc A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15030Protein Elastase [50536] (3 species)
  7. 15036Species Pig (Sus scrofa) [TaxId:9823] [50538] (42 PDB entries)
  8. 15047Domain d1elca_: 1elc A: [26250]

Details for d1elca_

PDB Entry: 1elc (more details), 1.75 Å

PDB Description: Analogous inhibitors of elastase do not always bind analogously
PDB Compounds: (A:)

SCOP Domain Sequences for d1elca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elca_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1elca_:

Click to download the PDB-style file with coordinates for d1elca_.
(The format of our PDB-style files is described here.)

Timeline for d1elca_: