Lineage for d1elca_ (1elc A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Elastase [50536] (3 species) Species Pig (Sus scrofa) [TaxId:9823] [50538] (42 PDB entries) 
Domain d1elca_: 1elc A: [26250]
Details for d1elca_
PDB Entry: 1elc (more details), 1.75 Å
PDB Description: Analogous inhibitors of elastase do not always bind analogously
PDB Compounds: (A:) SCOP Domain Sequences for d1elca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elca_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
SCOP Domain Coordinates for d1elca_:
Click to download the PDB-style file with coordinates for d1elca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1elca_:
- d1elca_ appears in SCOP 1.57
- d1elca_ appears in the current release, SCOPe 2.07
View in 3D