SCOP 1.75: Domain d1e38b_: 1e38 B:

Lineage for d1e38b_ (1e38 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (94 PDB entries)

8. Domain d1e38b_: 1e38 B: [26249]
   complexed with ca, so4, tpy

Details for d1e38b_

PDB Entry: 1e38, 1.7 Å

PDB Description: porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for 2 minutes

PDB Compounds: (B:) elastase

SCOP Domain Sequences for d1e38b_:

Sequence; same for both SEQRES and ATOM records:

>d1e38b_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1e38b_:

• d1e38b_ first appeared (with stable ids) in SCOP 1.55
  
• d1e38b_ appears in SCOP 1.73
  
• d1e38b_ appears in SCOPe 2.01
  
• d1e38b_ appears in the current release, SCOPe 2.08