Lineage for d1e38b_ (1e38 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056282Protein Elastase [50536] (4 species)
  7. 2056299Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)
  8. 2056359Domain d1e38b_: 1e38 B: [26249]
    complexed with ca, so4, tpy

Details for d1e38b_

PDB Entry: 1e38 (more details), 1.7 Å

PDB Description: porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for 2 minutes
PDB Compounds: (B:) elastase

SCOPe Domain Sequences for d1e38b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e38b_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d1e38b_:

Click to download the PDB-style file with coordinates for d1e38b_.
(The format of our PDB-style files is described here.)

Timeline for d1e38b_: